PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_4AL_40E835A94.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 268aa    MW: 30558.2 Da    PI: 7.2243
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_4AL_40E835A94.2genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.12e-18449147
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
        Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                           rg W + Ede+l+++v+++G+++W++Ia++++ gR++k+c++rw++ 
  Traes_4AL_40E835A94.2  4 RGHWRPSEDERLKELVARYGPHNWNAIAEKLQ-GRSGKSCRLRWFNQ 49
                           899*****************************.***********996 PP

2Myb_DNA-binding52.21.4e-165699146
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
        Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                           r ++++eE+ell+  ++ +G++ W+ Iar ++ gRt++ +k++w+ 
  Traes_4AL_40E835A94.2 56 RSPFSEEEEELLLASHRVHGNR-WAVIARLFP-GRTDNAVKNHWHV 99
                           789*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.805154IPR017930Myb domain
SMARTSM007174.7E-15352IPR001005SANT/Myb domain
SuperFamilySSF466894.49E-29497IPR009057Homeodomain-like
PfamPF002497.3E-18449IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-26557IPR009057Homeodomain-like
CDDcd001672.54E-13748No hitNo description
SMARTSM007174.5E-1555103IPR001005SANT/Myb domain
PROSITE profilePS5129419.90255105IPR017930Myb domain
PfamPF002498.2E-145698IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.6E-2058104IPR009057Homeodomain-like
CDDcd001671.72E-57198No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 268 aa     Download sequence    Send to blast
MCTRGHWRPS EDERLKELVA RYGPHNWNAI AEKLQGRSGK SCRLRWFNQL DPRINRSPFS  60
EEEEELLLAS HRVHGNRWAV IARLFPGRTD NAVKNHWHVI MARRCRERMR LSSNRRATPA  120
AASTTTAGAE KDESPKNTTG GEKPRLPETN TMAALLHKYR REFAAPFAIS HHSSKEGYCS  180
STNEDTNRSV EFYDFLQVNV SSSDTKCGSS IEENRDDDDD QQAEGQVSLI DFMELVMLCE  240
EAGPCYICSN LTPNILIEEA KRNAKVYI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C4e-3411051105C-Myb DNA-Binding Domain
1msf_C4e-3411051105C-Myb DNA-Binding Domain
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKJ7281911e-136KJ728191.1 Zea mays clone pUT6465 MYB transcription factor (MYB77) mRNA, partial cds.
GenBankKJ7281921e-136KJ728192.1 Zea mays clone pUT6466 MYB transcription factor (MYB37) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003560528.11e-126PREDICTED: transcription factor MYB44-like
TrEMBLW5DNE50.0W5DNE5_WHEAT; Uncharacterized protein
STRINGMLOC_78895.11e-146(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP29438260
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G73410.14e-68myb domain protein 54
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]